General Information

  • ID:  hor001856
  • Uniprot ID:  P81277
  • Protein name:  Prolactin-releasing peptide PrRP20
  • Gene name:  PRLH
  • Organism:  Homo sapiens (Human)
  • Family:  FMRFamide related peptide family
  • Source:  Human
  • Expression:  Medulla oblongata and hypothalamus.
  • Disease:  Diseases associated with PRLH include Precocious Puberty, Central, 1.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031861 prolactin-releasing peptide receptor binding
  • GO BP:  GO:0001894 tissue homeostasis; GO:0002021 response to dietary excess; GO:0006112 energy reserve metabolic process; GO:0006629 lipid metabolic process; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0009749 response to glucose; GO:0032868 response to insulin; GO:0040014 regulation of multicellular organism growth; GO:0042755 eating behavior; GO:0043434 response to peptide hormone; GO:0045444 fat cell differentiation; GO:0048483 autonomic nervous system development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TPDINPAWYASRGIRPVGRF
  • Length:  20
  • Propeptide:  MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQDG
  • Signal peptide:  MKVLRAWLLCLLMLGLALRGAA
  • Modification:  T20 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates prolactin (PRL) release and regulates the expression of prolactin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PRLHR
  • Target Unid:  P49683
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9EPV8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9EPV8-F1.pdbhor001856_AF2.pdbhor001856_ESM.pdb

Physical Information

Mass: 261265 Formula: C104H157N31O27
Absent amino acids: CEHKLMQ Common amino acids: PR
pI: 11.05 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 7
Hydrophobicity: -51 Boman Index: -4154
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 63.5
Instability Index: 4191.5 Extinction Coefficient cystines: 6990
Absorbance 280nm: 367.89

Literature

  • PubMed ID:  NA
  • Title:  NA